PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.042320.1
Common NameCsa_3G061560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 534aa    MW: 58673.2 Da    PI: 6.6558
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.042320.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.11.4e-31210267260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d+++++i+Y+g+H+h+k
  Cucsa.042320.1 210 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITDIIYKGTHDHPK 267
                     8****************************************.***************85 PP

2WRKY105.43.1e-33385443159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct  gCpv+k+ver+++dpk+v++tYeg+Hnh+
  Cucsa.042320.1 385 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNVGCPVRKHVERASHDPKAVITTYEGKHNHD 443
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.376204268IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.7E-27205268IPR003657WRKY domain
SuperFamilySSF1182907.06E-25206268IPR003657WRKY domain
SMARTSM007741.0E-33209267IPR003657WRKY domain
PfamPF031062.3E-24210266IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-37370445IPR003657WRKY domain
SuperFamilySSF1182902.62E-29377445IPR003657WRKY domain
PROSITE profilePS5081138.549380445IPR003657WRKY domain
SMARTSM007745.3E-39385444IPR003657WRKY domain
PfamPF031068.4E-26386443IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MDPTDSDLPD PSNASSGAKY KLLSPAKLPI SRSPCITIPP GLSPTSFLDS PVLLTNLKVE  60
PSPTTGSFTK LPMAHDSSGS AIYPMTSMAF SNTNASDEGR SNYFEFKPYV GPNMVPADLS  120
HRKGEQFSEV QGQPQPFTAP PMTKMEISVM SNDLSRSTQM DTHTVASGVS VPEANGDEIN  180
HSLNTNSRVQ APQSDPKGSG IPVVSDRLSD DGYNWRKYGQ KHVKGSEFPR SYYKCTHPNC  240
EVKKLFERSH DGQITDIIYK GTHDHPKPQP SRRYSASASM NVQEDGTDKP SSLPGQDDRS  300
CSMYAQTMHT IEPNGTTDPS MPANDRITEG AGTTLPCKNH DEVDDDDIYL KRRKMELGGF  360
DVCPMVKPIR EPRVVVQTLS EVDILDDGYR WRKYGQKVVR GNPNPRSYYK CTNVGCPVRK  420
HVERASHDPK AVITTYEGKH NHDVPTAKTS SHDVTGPSTI PSSRYRLEES DTISLDLGVG  480
IGTGGENRSN EYRQALHSQL VENRAPSGNF NFEVVQENSA PTYFGVLNRS VIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-36199445677Probable WRKY transcription factor 4
1wj2_A1e-36199445677Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840170.0GU984017.1 Cucumis sativus WRKY protein (WRKY17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275533.10.0probable WRKY transcription factor 20-like
SwissprotQ93WV01e-169WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A0A0L2V10.0A0A0A0L2V1_CUCSA; Uncharacterized protein
STRINGGLYMA02G46690.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-170WRKY family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]